The short version of RP-HPLC fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-15. Anything still debated is marked as such rather than presented as settled.
The primary target is the GLP-1 receptor, a class B G protein-coupled receptor expressed on pancreatic beta cells, in the gut, and in several brain regions. Receptor activation raises intracellular cyclic AMP, which potentiates glucose-dependent insulin secretion and lowers glucagon release when blood glucose is elevated. Signalling in the hypothalamus and brainstem is associated with reduced appetite and slower gastric emptying. Because the insulinotropic effect depends on prevailing glucose levels, the hypoglycaemic risk of the peptide alone is described as low in most study settings. The relative contribution of peripheral and central actions remains an active research question.
Large randomised trials in adults with type 2 diabetes and in adults with obesity have reported reductions in body weight and improvements in several cardiovascular risk markers. One outcome trial found a lower incidence of major adverse cardiovascular events in participants with diabetes and established cardiovascular disease. Gastrointestinal effects such as nausea and vomiting are the most frequently reported adverse events and often diminish over time. Changes in lean body mass during weight loss are an area of ongoing investigation. Effects in adolescents and in pregnancy are less well characterised, and current labelling advises against use during pregnancy.
Semaglutide is a synthetic peptide analog of glucagon-like peptide-1, a hormone released from intestinal L cells after food intake. The molecule is a 31-amino-acid backbone modified at three positions to resist cleavage by dipeptidyl peptidase-4, the enzyme that degrades native GLP-1 within minutes. A lysine residue at position 26 carries a linker and a C18 fatty diacid, which promotes binding to serum albumin and slows renal clearance. These changes extend the circulating half-life from roughly two minutes to about one week in humans.
The sequence incorporates alpha-aminoisobutyric acid at position 8, replacing the alanine found in the natural hormone. This substitution blocks the primary DPP-4 recognition site and contributes most of the enzymatic stability. Albumin binding further protects the peptide and reduces the frequency of administration required to maintain active plasma levels. Because the fatty acid chain increases lipophilicity, the compound is formulated as a solution rather than a simple aqueous buffer. Researchers describe the design as an incremental optimization of earlier GLP-1 analogs rather than a wholly new scaffold.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Acylated GLP-1 receptor agonist | 31-residue synthetic peptide |
| Molecular formula | C187H291N45O59 | established for the free peptide |
| Appearance | White to off-white powder | as supplied before formulation |
| Solubility | Freely soluble in water | aqueous buffers near neutral pH |
| Typical storage | 2 to 8 degrees Celsius, protected from light | powder and solution forms differ in shelf life |
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 or 280 nanometres is widely used to assess purity and to resolve related impurities. Liquid chromatography coupled to mass spectrometry confirms identity through the protonated molecular ion and fragment ions formed in tandem experiments. Capillary electrophoresis and peptide mapping after enzymatic digestion supply complementary information on charge variants and modification sites. Circular dichroism and nuclear magnetic resonance can report on secondary structure in solution. Absolute quantification usually depends on an external standard, and reported purity depends on the detection wavelength and integration parameters chosen.
Lyophilised material appears as a white to off-white cake or powder that is hygroscopic, and containers are usually equilibrated to room temperature before opening to limit condensation. Dissolution is performed in water, phosphate-buffered saline, or a mildly alkaline buffer, since solubility rises above neutral pH. Gentle inversion or low-speed mixing is preferred, because vigorous vortexing can promote surface denaturation and aggregation. Complete dissolution may require several minutes, and brief sonication is sometimes applied. Passing the solution through a 0.22 micrometre membrane removes particulates but does not by itself sterilise the liquid.
Identity and purity are usually assessed by reverse-phase high-performance liquid chromatography coupled to mass spectrometry. Retention time and observed mass are compared against a reference standard run under identical conditions. Impurity profiles reveal deamidation products, oxidized methionine variants, and truncated fragments that arise during synthesis or storage. Peptide mapping through enzymatic digestion confirms the primary sequence, while amino acid analysis offers an independent check on overall composition.
Stability studies examine how temperature, pH, and moisture influence degradation rates over time. In aqueous solution, hydrolysis and deamidation accelerate as pH moves away from mildly acidic conditions. Light exposure and residual metal ions can also trigger oxidation of susceptible residues. Accelerated aging at elevated temperature is used to estimate shelf life, though extrapolation to room temperature carries uncertainty because individual degradation pathways do not always scale predictably.
Lyophilized semaglutide powder is typically held at minus twenty degrees Celsius for long-term storage. At that temperature, solid-state degradation reactions proceed slowly and the peptide remains intact for extended periods. Repeated freeze-thaw cycles are best avoided because they promote aggregation and can shift the proportion of monomeric peptide present. Working aliquots are often prepared so that each portion is thawed only once, and desiccant is placed inside the vial to limit moisture uptake.
Reverse-phase high-performance liquid chromatography is the standard method for purity assessment, separating the peptide from truncated or oxidized variants. Mass spectrometry confirms molecular mass and detects modifications, while ultraviolet absorbance near 280 nanometers supports concentration measurement through tryptophan and tyrosine residues. Circular dichroism can indicate secondary structure, though the peptide is largely helical in solution, and ion-exchange chromatography resolves charge variants. Purity values above 95 percent are typical for research-grade material. Stability studies track degradation over time under defined conditions.
Lyophilized semaglutide is typically stored at temperatures between minus 20 and minus 80 degrees Celsius for long-term preservation. Short-term storage at 2 to 8 degrees Celsius is common for working aliquots. Repeated freeze-thaw cycles can degrade the peptide and are usually avoided. The molecule is hygroscopic in its solid form, so containers should remain sealed with desiccant. Solutions are less stable than powders and are generally prepared fresh. Light exposure is limited because aromatic residues can undergo photo-oxidation.
The first submarines were propelled by humans. The first mechanically driven submarine was the 1863 French Plongeur, which used compressed air for propulsion. Anaerobic propulsion was first employed by the Spanish Ictineo II in 1864, which used a solution of zinc, manganese dioxide, and potassium chlorate to generate sufficient heat to power a steam engine, while also providing oxygen for the crew. A similar system was not employed again until 1940 when the German Navy tested a hydrogen peroxide-based system, the Walter turbine, on the experimental V-80 submarine and later on the naval U-791 and type XVII submarines; the system was further developed for the British Explorer-class, completed in 1958. Until the advent of nuclear marine propulsion, most 20th-century submarines used electric motors and batteries for running underwater and combustion engines on the surface, and for battery recharging. Early submarines used gasoline (petrol) engines but this quickly gave way to kerosene (paraffin) and then diesel engines because of reduced flammability and, with diesel, improved fuel-efficiency and thus also greater range. A combination of diesel and electric propulsion became the norm. Initially, the combustion engine and the electric motor were in most cases connected to the same shaft so that both could directly drive the propeller. The combustion engine was placed at the front end of the stern section with the electric motor behind it followed by the propeller shaft.
2,5-Diketopiperazine is an organic compound with the formula (NHCH2C(O))2. The compound features a six-membered ring containing two amide groups at opposite positions in the ring. It was first compound containing a peptide bond to be characterized by X-ray crystallography in 1938. It is the parent of a large class of 2,5-Diketopiperazines (2,5-DKPs) with the formula (NHCH2(R)C(O))2 (R = H, CH3, etc.). They are ubiquitous peptides in nature. They are often found in fermentation broths and yeast cultures as well as embedded in larger more complex architectures in a variety of natural products as well as several drugs. In addition, they are often produced as degradation products of polypeptides, especially in foods and beverages. They have also been found in extraterrestrial objects such as comets and asteroids.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
The second modification allows a substantial simplification of the classic theory, and so application in complex metabolic networks. The theory on synthesizing units is used in dynamic energy budget theory, where 4 basic modes are distinguished: the substrates can be substitutable or supplementary (= complementary); if the transformations A -> C and B -> C can occur, substrates A and B are said to be substitutable with respect to their transformation to C, if both are required to produce C they are said to be supplementary the processing of these substrates by SUs can be sequential or parallel; if in the transformation A + B -> C the binding of substrate A to the SU does not affect that of B, these substrates are processed simultaneously, if not these substrates are processed sequentially Mixtures of the 4 basic modes can occur, especially if the substrates represent generalized compounds, rather than pure chemical compounds. A generalized compound is a mixture of chemical compounds that does not change in composition.
Unlike anandamide, formation of 2-AG is calcium-dependent and is mediated by the activities of phospholipase C (PLC) and diacylglycerol lipase (DAGL). 2-AG acts as a full agonist at the CB1 receptor. At a concentration of 0.3 nM, 2-AG induces a rapid, transient increase in intracellular free calcium in NG108-15 neuroblastoma X glioma cells through a CB1 receptor-dependent mechanism. 2-AG is hydrolyzed in vitro by monoacylglycerol lipase (MAGL), fatty acid amide hydrolase (FAAH), and the uncharacterized serine hydrolase enzymes ABHD2, ABHD6 and ABHD12. The exact contribution of each of these enzymes to the termination of 2-AG signaling in vivo is unknown, though it is estimated that MAGL is responsible for ~85% of this activity in the brain. There have been identified transport proteins for 2-arachidonoylglycerol and anandamide. These include the heat shock proteins (Hsp70s) and fatty acid binding proteins (FABPs).
Sources: en.wikipedia.org
In 2011, actor John Abraham responding to allegations that his face looked "puffy" from steroid use stated that he used "No steroids" and used protein and multivitamins. In a 2013 interview, British-Indian model Upen Patel also refutes ever taking steroids, and states that he was always athletic. In 2018, actor Sanjay Dutt refused the allegations that his 1990s physique was due to steroids use, arguing that back then both steroids and protein powders weren't widespread, Dutt saying that he relied only on diet. http://in.movies.yahoo.com/news-detail/17113/Stars-steroids-enhance-performance.html
62. Tirzepatide. Farzam K(1), Patel P. In: StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2026 Jan–. 2026 Sep 14. Author information: (1)McMaster University Tirzepatide is a medication approved by the US Food and Drug Administration (FDA) for the treatment of type 2 diabetes, obesity, and obstructive sleep apnea. As a dual agonist of the glucagon-like peptide-1 and glucose-dependent insulinotropic polypeptide receptors, it improves glycemic control and reduces body weight in patients with type 2 diabetes. Administered once weekly via subcutaneous injection with incremental dose adjustments, tirzepatide is used as a second-line diabetes medication. Tirzepatide is not approved for the treatment of type 1 diabetes and has not been adequately studied in patients with pancreatitis. Common adverse effects are gastrointestinal, including nausea, vomiting, and diarrhea. This activity provides an overview of the indications, mechanism of action, administration, adverse effects, contraindications, drug interactions, and considerations for specific patient populations. The activity also enhances clinicians’ competence in administering tirzepatide, monitoring treatment response and adverse effects, and managing patients with type 2 diabetes to improve patient outcomes and safety. Copyright © 2026, StatPearls Publishing LLC.
=== Cold fusion === 208Pb(48Ca,xn)256−xNo (x=1,2,3,4) This cold fusion reaction was first studied in 1979 at Flerov Laboratory of Nuclear Reactions (FLNR). Further work in 1988 at GSI measured EC and SF branchings in 254No. In 1989, the FLNR used the reaction to measure SF decay characteristics for the two isomers of 254No. The measurement of the 2n excitation function was reported in 2001 by Yuri Oganessian at the FLNR. Patin et al. at the LBNL reported in 2002 the synthesis of 255–251No in the 1-4n exit channels and measured further decay data for these isotopes. The reaction has recently been used at Jyväskylän Yliopisto Fysiikan Laitos (JYFL) using the RITU set-up to study K-isomerism in 254No. The scientists were able to measure two K-isomers with half-lives of 275 ms and 198 s, respectively. They were assigned to 8− and 16+ K-isomeric levels. The reaction was used in 2004–5 at the FLNR to study the spectroscopy of 255–253No. The team were able to confirm an isomeric level in 253No with a half-life of 43.5 s.
Buchanan had last appeared at the U.S. Open, where she had lost in the second round in the women's singles tournament in September, and was ranked at 105th in the world by the Women's Tennis Association.
== Genetics == Hemoglobin consists of protein subunits (globin molecules), which are polypeptides, long folded chains of specific amino acids which determine the protein's chemical properties and function. The amino acid sequence of any polypeptide is translated from a segment of DNA, the corresponding gene. There is more than one hemoglobin gene. In humans, hemoglobin A (the main form of hemoglobin in adults) is coded by genes HBA1, HBA2, and HBB. Alpha 1 and alpha 2 subunits are respectively coded by genes HBA1 and HBA2 close together on chromosome 16, while the beta subunit is coded by gene HBB on chromosome 11. The amino acid sequences of the globin subunits usually differ between species, with the difference growing with evolutionary distance. For example, the most common hemoglobin sequences in humans, bonobos and chimpanzees are completely identical, with exactly the same alpha and beta globin protein chains. Human and gorilla hemoglobin differ in one amino acid in both alpha and beta chains, and these differences grow larger between less closely related species. Mutations in the genes for hemoglobin can result in variants of hemoglobin within a single species, although one sequence is usually "most common" in each species. Many of these mutations cause no disease, but some cause a group of hereditary diseases called hemoglobinopathies. The best known hemoglobinopathy is sickle-cell disease, which was the first human disease whose mechanism was understood at the molecular level.
Sources: en.wikipedia.org
=== Non-pharmacological treatments === A multi-disciplinary care team is often used in the treatment of JIA. One of the ways occupational or physical therapists help young children with JIA is by developing a home therapy program based around play. Exercises are prescribed by both physical therapists and occupational therapists to increase the range a child can move a joint, to strengthen the muscles around a joint, to decrease pain and stiffness and to prevent further limitations in their joint movements. OTs and PTs can provide children with age-appropriate games and activities to allow the children to practice their exercises while playing and socializing with friends. Examples are crafts, swimming, and sports. Surgery is only used to treat the most severe cases of JIA and is now rarely required.
Many other binary nitrogen hydrides are known, but the most important are hydrazine (N2H4) and hydrogen azide (HN3). Although it is not a nitrogen hydride, hydroxylamine (NH2OH) is similar in properties and structure to ammonia and hydrazine as well. Hydrazine is a fuming, colourless liquid that smells similar to ammonia. Its physical properties are very similar to those of water (melting point 2.0 °C, boiling point 113.5 °C, density 1.00 g/cm3). Despite it being an endothermic compound, it is kinetically stable. It burns quickly and completely in air very exothermically to give nitrogen and water vapour. It is a very useful and versatile reducing agent and is a weaker base than ammonia. It is also commonly used as a rocket fuel. Hydrazine is generally made by reaction of ammonia with alkaline sodium hypochlorite in the presence of gelatin or glue:
He wrote that: "They want to control our brotherhood... It is up to authentic Cuban Freemasons to prevent any of this from happening; once aware of the ever-growing influence State Security seeks to exert over our institution, we must not allow anyone likely linked to these agencies to assume the position." After arriving in the United States, Alfonso Vidal told reporters that former Grand Master Zamora Fernández, despite publicly appearing to stand against the injustice of the Cuban government, had privately apologized to the Communist Party. Alfonso Vidal said that at a special session of the Cuban Supreme Court of Masonic Justice, Zamora Fernández accused Master Mason Brian José Infante Machín from Logia Luz Caballero (English: Luz Caballero Lodge) of leading a conspiracy against the government, after which the Supreme Court expelled Infante Machín. Alfonso Vidal said that: "Zamora Fernández is weak-willed; his desire for recognition makes him vulnerable to State Security. I caught him crying the day he had to leave his post, and even now he hasn't come to terms with the fact that he's no longer the Grand Master. State Security takes advantage of all this; they seem to study your profile. They repeatedly emphasized that I was a noble and humble person, and that's how they approached me. Furthermore, officials from the Office of Religious Affairs speak very highly of him; in fact, they were confident that I would follow in Zamora's footsteps." He also called on the Freemasons of Cuba to elect Viñas Alonso as the Grand Master of Cuba.
==== Financing residency programs ==== The US Department of Health and Human Services, primarily Medicare, funds the vast majority of residency training in the US. This tax-based financing covers resident salaries and benefits through payments called Direct Medical Education, or DME, payments. Medicare also uses taxes for Indirect Medical Education, or IME payments, a subsidy paid to teaching hospitals that is tied to admissions of Medicare patients in exchange for training resident physicians in certain selected specialties. Overall funding levels, however, have remained frozen over the last ten years, creating a bottleneck in the training of new physicians in the US, according to the AMA. On the other hand, some argue that Medicare subsidies for training residents simply provide surplus revenue for hospitals, which recoup their training costs by paying residents salaries that are far below the residents' market value. Nicholson concludes that residency bottlenecks are not caused by a Medicare funding cap, but rather by Residency Review Committees (which approve new residencies in each specialty), which seek to limit the number of specialists in their field to maintain high incomes. In any case, hospitals trained residents long before Medicare provided additional subsidies for that purpose. A large number of teaching hospitals fund resident training to increase the supply of residency slots, leading to the modest 4% total growth in slots from 1998 to 2004.
Sources: en.wikipedia.org
Native GLP-1 is degraded within minutes by dipeptidyl peptidase-4 and neutral endopeptidases. Semaglutide carries a non-natural amino acid at position eight that blocks that cleavage, and a fatty diacid side chain that binds albumin. The result is a much longer duration of action than the native hormone.
The fatty diacid chain associates strongly with serum albumin, which keeps the peptide in circulation and shields it from rapid renal clearance. Bound peptide is released gradually, producing a sustained receptor signal. This mechanism also reduces the peak-to-trough variation seen with shorter-acting analogues.
The balance between peripheral receptor activation and signalling in the central nervous system is not fully resolved. The extent to which slowed gastric emptying accounts for reduced energy intake, compared with direct effects on appetite circuits, is debated. Long-term effects on lean mass and on tissues outside the gut and brain are still under study.
It is a modified version of the natural hormone, with three amino acid changes and a fatty acid side chain added. These edits extend its half-life from minutes to about one week. The core receptor activity is retained.